Anti-FAM19A3/TAFA3 antibody (ab231207)
Key features and details
- Rabbit polyclonal to FAM19A3/TAFA3
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FAM19A3/TAFA3 antibody -
Description
Rabbit polyclonal to FAM19A3/TAFA3 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human FAM19A3/TAFA3 aa 44-130. Expressed in E.coli.
Sequence:GTCEVIAAHRCCNRNRIEERSQTVKCSCFSGQVAGTTRAKPSCVDASIVL QRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTK
Database link: Q7Z5A8 -
Positive control
- WB: Human liver tissue, A549 cell lysate. Recombinant human FAM19A3/TAFA3 protein. IHC-P: Human lung, brain, skin cancer, kidney, breast cancer and prostate tissues.
-
General notes
This product was previously labelled as FAM19A3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab231207 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 15 kDa. |
Target
-
Relevance
This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP 1alpha, a member of the CC chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 284467 Human
- SwissProt: Q7Z5A8 Human
-
Alternative names
- Chemokine like protein TAFA3 antibody
- Family with sequence similarity 19 (chemokine (C C motif) like) member A3 antibody
- TAFA 3 antibody
- TAFA3 antibody
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human kidney tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human skin cancer tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human brain tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM19A3/TAFA3 antibody (ab231207)
Formalin-fixed, paraffin-embedded human lung tissue stained for FAM19A3/TAFA3 using ab231207 at 20 µg/mL in immunohistochemical analysis.
-
All lanes : Anti-FAM19A3/TAFA3 antibody (ab231207) at 2 µg/ml
Lane 1 : Human liver tissue lysate
Lane 2 : A549 (human lung carcinoma cell line) cell lysate
Predicted band size: 15 kDa -
Anti-FAM19A3/TAFA3 antibody (ab231207) at 2 µg/ml + Recombinant human FAM19A3/TAFA3 protein
Predicted band size: 15 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231207 has not yet been referenced specifically in any publications.