Overview

  • Product name

    Anti-FAM19A4 antibody
  • Description

    Rabbit polyclonal to FAM19A4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 42-91 (

    VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA

    ) of rat FAM19A4 (NP_001128172).

  • Positive control

    • rat kidney lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab133927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Relevance

    FAM19A4 is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Chemokine like protein TAFA 4 antibody
    • Family with sequence similarity 19 (chemokine (C C motif) like) member A4 antibody
    • Family with sequence similarity 19 member A4 antibody
    • FLJ25161 antibody
    • Protein FAM19A4 antibody
    • TAFA 4 antibody
    • TAFA4 antibody
    see all

Images

  • Anti-FAM19A4 antibody (ab133927) at 1 µg/ml + rat kidney lysate at 10 µg

    Predicted band size: 15 kDa

References

ab133927 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up