Anti-FAM208A antibody (ab224393)

Submit a review Submit a question
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM208A antibody (ab224393)
  • Immunocytochemistry/ Immunofluorescence - Anti-FAM208A antibody (ab224393)

Key features and details

  • Rabbit polyclonal to FAM208A
  • Suitable for: IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-FAM208A antibody

  • Description

    Rabbit polyclonal to FAM208A

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse

  • Immunogen

    Recombinant fragment corresponding to Human FAM208A aa 1361-1492.
    Sequence:

    GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCD SQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAE DFMQNFKNLVGYHNSITEENLPQLGANENLES


    Database link: Q9UK61
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC: Human liver tissue. ICC/IF: U-2 OS cells.

  • General notes

     This product was previously labelled as Protein TASOR

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3.

  • Sequence similarities

    Belongs to the FAM208 family.

  • Post-translational
    modifications

    Asn-1105 may be N-glycosylated; however as this position is probably not extracellular, the in vivo relevance is not proven.

  • Cellular localization

    Nucleus. Chromosome. Localizes to chromatin.
  • Information by UniProt

  • Database links

    • Alternative names

      • CTCL tumor antigen se89-1 antibody
      • fam208a antibody
      • Protein TASOR antibody
      • Retinoblastoma-associated protein RAP140 antibody
      • TASOR_HUMAN antibody
      • Transgene activation suppressor protein antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM208A antibody (ab224393)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM208A antibody (ab224393)

      Paraffin-embedded human liver tissue stained for FAM208A using ab224393 at 1/200 dilution in immunohistochemical analysis.

    • Immunocytochemistry/ Immunofluorescence - Anti-FAM208A antibody (ab224393)
      Immunocytochemistry/ Immunofluorescence - Anti-FAM208A antibody (ab224393)

      PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for FAM208A (green) using ab224393 at 4 µg/ml in ICC/IF.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab224393? Please let us know so that we can cite the reference in this datasheet.

    ab224393 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab224393.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com