Anti-FAM208A antibody (ab224393)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FAM208A antibody -
Description
Rabbit polyclonal to FAM208A -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse
-
Immunogen
Recombinant fragment corresponding to Human FAM208A aa 1361-1492.
Sequence:GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCD SQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAE DFMQNFKNLVGYHNSITEENLPQLGANENLES
Database link: Q9UK61 -
Positive control
- IHC: Human liver tissue. ICC/IF: U-2 OS cells.
-
General notes
This product was previously labelled as Protein TASOR
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224393 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3. -
Sequence similarities
Belongs to the FAM208 family. -
Post-translational
modificationsAsn-1105 may be N-glycosylated; however as this position is probably not extracellular, the in vivo relevance is not proven. -
Cellular localization
Nucleus. Chromosome. Localizes to chromatin. - Information by UniProt
-
Database links
- Entrez Gene: 23272 Human
- SwissProt: Q9UK61 Human
- SwissProt: Q69ZR9 Mouse
- Unigene: 116877 Human
-
Alternative names
- CTCL tumor antigen se89-1 antibody
- fam208a antibody
- Protein TASOR antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FAM208A antibody (ab224393)Paraffin-embedded human liver tissue stained for FAM208A using ab224393 at 1/200 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-FAM208A antibody (ab224393)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for FAM208A (green) using ab224393 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab224393 has not yet been referenced specifically in any publications.
