Overview

  • Product name

    Anti-FAM26F antibody - C-terminal
    See all FAM26F primary antibodies
  • Description

    Rabbit polyclonal to FAM26F - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human FAM26F aa 266-295 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    FNPKGQYYSMLHKYVNRKEKTHSIRSTEGD


    Database link: Q5R3K3

  • Positive control

    • Human skeletal muscle tissue and NCI-H460 cell line lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.
WB 1/1000. Predicted molecular weight: 34 kDa.

Target

  • Function

    Pore-forming subunit of a voltage-gated ion channel.
  • Sequence similarities

    Belongs to the FAM26 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C6orf187 antibody
    • dJ93H18.5 antibody
    • FA26F_HUMAN antibody
    • Fam26f antibody
    • Family with sequence similarity 26, member F antibody
    • hypothetical protein LOC441168 antibody
    • OTTHUMP00000017061 antibody
    • OTTHUMP00000017062 antibody
    • Protein FAM26F antibody
    • RP1-93H18.5 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skeletal msucle tissue, labeling FAM26F using ab194946 at a 1/100 dilution.

  • All lanes : Anti-FAM26F antibody - C-terminal (ab194946) at 1/1000 dilution

    Lane 1 : NCI-H460 cell lysate
    Lane 2 : NCI-H460 cell lysate with blocking peptide

    Predicted band size: 34 kDa

References

ab194946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up