Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM40A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human FAM40A aa 352-381 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    RREHKALIKQDNLDAFNERDPYKADDSREE


    Database link: Q5VSL9

  • Positive control

    • Human skeletal muscle tissue; HeLa cell lysate; Mouse brain and liver tissue lysates; HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab211303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/10 - 1/50.
IHC-P 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human skeletal muscle tissue labeling FAM40A with ab211303 at 1/100 dilution.

  • Flow cytometry analysis of HeLa cells (right histogram) labeling FAM40A using ab211303 at 1/10 dilution, followed by FITC-conjugated goat-anti-rabbit secondary antibody detection. Left histogram: negative control cells.

References

ab211303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up