Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM46C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human FAM46C aa 1-391.
    Sequence:

    MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKD IVQTVRSRLEEAGIKVHDVRLNGSAAGHVLVKDNGLGCKDLDLIFHVALP TEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQKLVKVCTDTD RWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNN PISEHFHPTVIGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNL LVRDFRPTDQEEIKTLERYMCSRFFIDFPDILEQQRKLETYLQNHFAEEE RSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCN


    Database link: Q5VWP2

  • Positive control

    • WB: Mouse heart tissue lysate. IHC-P: Human brain tissue. ICC/IF: HepG2 (human liver hepatocellular carcinoma cell line) cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 45, 35 kDa (predicted molecular weight: 45 kDa).
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-FAM46C antibody (ab222808) at 1/1000 dilution + mouse heart lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 45 kDa
    Observed band size: 35,45 kDa
    why is the actual band size different from the predicted?

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FAM46C (green) using ab222808 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human brain tissue stained for FAM46C using ab222808 at 1/100 dilution in immunohistochemical analysis.

References

ab222808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up