Overview

  • Product name

    Anti-FAM53B antibody
  • Description

    Rabbit polyclonal to FAM53B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FAM53B aa 1-305.
    Sequence:

    MVMVLSESLSTRGADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWR DLDRKCPLQIDQPSTSIWECLPEKDSSLWHREAVTACAVTSLIKDLSISD HNGNPSAPPSKRQCRSLSFSDEMSSCRTSWRPLGSKVWTPVEKRRCYSGG SVQRYSNGFSTMQRSSSFSLPSRANVLSSPCDQAGLHHRFGGQPCQGVPG SAPCGQAGDTWSPDLHPVGGGRLDLQRSLSCSHEQFSFVEYCPPSANSTP ASTPELARRSSGLSRSRSQPCVLNDKKVGVKRRRPEEVQEQRPSLDLAKM AQIAP


    Database link: Q14153-2

  • Positive control

    • WB: MCF7, A549 and HCT 116 whole cell lysates. IHC-P: Human breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 46 kDa.
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Detected in skeletal muscle, kidney, spleen, thyroid, testis, ovary, small intestine, colon and peripheral blood.
  • Sequence similarities

    Belongs to the FAM53 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA12J10.2 antibody
    • FA53B_HUMAN antibody
    • FAM 53B antibody
    • Fam53b antibody
    • Family with sequence similarity 53 member B antibody
    • Hypothetical protein LOC9679 antibody
    • KIAA0140 antibody
    • Protein FAM53B antibody
    • RP11 12J10.2 antibody
    see all

Images

  • All lanes : Anti-FAM53B antibody (ab235829) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HCT 116 (human colorectal carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 46 kDa

  • Paraffin-embedded human breast cancer tissue stained for FAM53B using ab235829 at 1/100 dilution in immunohistochemical analysis.

References

ab235829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up