Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM53C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Dog, Pig, Xenopus laevis, Non human primates, Xenopus tropicalis
  • Immunogen

    Recombinant fragment within Human FAM53C aa 342-392. The exact sequence is proprietary. (NP_001129119.1)
    Sequence:

    SCSPTGGSSQVLSESEEEEEGAVRWGRQALSKRTLCQRDFGDLDLNLIEE N


    Database link: Q9NYF3

  • Positive control

    • HeLa whole cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab180659 was affinity purified using an epitope specific to FAM53C immobilized on a solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 43 kDa.

ab180659 can be used for WB of enriched (e.g. immunoprecipitated) sources of FAM53C. However, the antibody has not performed satisfactorily when used for WB of FAM53C in crude preparations (e.g. whole cell lysate).

IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Immunoprecipitation of HeLa whole cell lysate using ab180659 at 6 µg/mg of lysate (1 mg/IP; 20% of IP loaded per lane), followed by detection of FAM53C with ab180659 at 1 µg/ml. The lysate in lane 2 is precipitated with an IgG control antibody.

References

ab180659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up