Anti-FAM57B antibody - C-terminal (ab182342)

Overview

  • Product name
    Anti-FAM57B antibody - C-terminal
  • Description
    Rabbit polyclonal to FAM57B - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human FAM57B aa 213-262 (C terminal). The exact sequence is proprietary.
    Sequence:

    WAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWP


    Database link: Q71RH2

  • Positive control
    • HeLa whole cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182342 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.

Target

Images

  • Anti-FAM57B antibody - C-terminal (ab182342) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Secondary
    Goat anti-rabbit IgG HRP conjugated antibody at 1/15000 dilution

    Developed using the ECL technique.

    Predicted band size: 31 kDa
    Additional bands at: 24 kDa (possible isoform)

References

ab182342 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (hippocampal neuron)
Permeabilization
Yes - 0.2%Triton
Specification
hippocampal neuron
Blocking step
Serum as blocking agent for 40 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 13 2015

Application
Immunocytochemistry/ Immunofluorescence
Sample
Monkey Cell (COS7)
Permeabilization
Yes - 0.2%Triton
Specification
COS7
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 22°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 07 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up