Overview

  • Product name

    Anti-FAM62C antibody
  • Description

    Rabbit polyclonal to FAM62C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM62C aa 552-639.
    Sequence:

    PYADLTLEQRFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKK GPLLIKKVATNQGPKAQPQEEGPTDLPCPPDPASDTKD


    Database link: A0FGR9

  • Positive control

    • IHC-P: Human smooth muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    FAM62C belongs to the extended synaptotagmin family. It is a single-pass membrane protein, and contains 3 C2 domains. FAM62C may play a role as calcium-regulated intrinsic membrane protein.
  • Cellular localization

    Cell membrane; Single-pass membrane protein.
  • Database links

  • Alternative names

    • CHR3SYT antibody
    • E Syt3 antibody
    • ESYT3 antibody
    • Extended synaptotagmin 3 antibody
    • Extended synaptotagmin-like protein 3 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human smooth muscle tissue stained for FAM62C using ab243419 at 1/50 dilution in immunohistochemical analysis.

References

ab243419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up