Overview

  • Product name

    Anti-FAM65B antibody
  • Description

    Rabbit polyclonal to FAM65B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human FAM65B aa 1-250.
    Sequence:

    MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRCNSFIENSSALKKPQA KLKKMHNLGHKNNNPPKEPQPKRVEEVYRALKNGLDEYLEVHQTELDKLT AQLKDMKRNSRLGVLYDLDKQIKTIERYMRRLEFHISKVDELYEAYCIQR


    Database link: Q9Y4F9

  • Positive control

    • IHC-P: Human skeletal muscle and endometrial cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Isoform 2 play a role in promoting myogenic cell differentiation, cytoskeletal rearrangement and filopodia formation.
  • Tissue specificity

    Isoform 1 is present in the brain. Isoform 2 is expressed during differentiation of fetal primary myoblasts. Also shows marked expression during cytotrophoblast differentiation.
  • Sequence similarities

    Belongs to the FAM65 family.
  • Post-translational
    modifications

    Asn-41 was reported (PubMed:16335952) to be N-glycosylated; however as this position is probably not extracellular, the in vivo relevance is not proven.
  • Cellular localization

    Mitochondrion and Cytoplasm > cytoskeleton. Cell projection > filopodium. Detected in cellular filopodia.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ab2 162 antibody
    • C6orf32 antibody
    • DIFF48 antibody
    • FA65B_HUMAN antibody
    • Fam65b antibody
    • KIAA0386 antibody
    • PL48 antibody
    • Protein FAM65B antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for FAM65B using ab234646 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrial cancer tissue stained for FAM65B using ab234646 at 1/100 dilution in immunohistochemical analysis.

References

ab234646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up