Overview

  • Product name

    Anti-FAM71D antibody
  • Description

    Rabbit polyclonal to FAM71D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 288-337 (

    TVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISNI

    ) of Human FAM71D (NP_775797)

  • Positive control

    • Fetal kidney lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: PBS, 2% Sucrose
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    FAM71D belongs to the FAM71 family. The specific function of the protein remains unknown.
  • Database links

  • Alternative names

    • 4921509E07Rik antibody
    • 4930516C23Rik antibody
    • C14orf54 antibody
    • Chromosome 14 open reading frame 54 antibody
    • Family with sequence similarity 71, member D antibody
    • FLJ36130 antibody
    • GARI-L2 antibody
    • Golgi-associated Rab2B interactor-like 2 antibody
    • Hypothetical protein LOC161142 antibody
    • Protein FAM71D antibody
    • RIKEN cDNA 4921509E07, isoform CRA_b antibody
    see all

Images

  • Anti-FAM71D antibody (ab90262) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 47 kDa



    Gel concentration: 12%

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up