For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    fam83d-antibody-ab236882.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromosome Structure Chromosome
Share by email

Anti-FAM83D antibody (ab236882)

  • Datasheet
  • SDS
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-FAM83D antibody (ab236882)
  • Immunocytochemistry/ Immunofluorescence - Anti-FAM83D antibody (ab236882)

Key features and details

  • Rabbit polyclonal to FAM83D
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
Knockout
Product image
Human FAM83D knockout HEK293T cell line (ab266371)
Primary
Product image
Anti-HURP antibody (ab70744)

View more associated products

Overview

  • Product name

    Anti-FAM83D antibody
  • Description

    Rabbit polyclonal to FAM83D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FAM83D aa 339-470.
    Sequence:

    STPRKADLDPEMPAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAID AATQTEPGEEMPGLSVSEVGTQTSITTACAGTQTAVITRIASSQTTIWSR STTTQTDMDENILFPRGTQSTEGSPVSKMSVS


    Database link: Q9H4H8
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: K562 and HEK-293T whole cell lysate. ICC/IF: HepG2 cells.
  • General notes

    Previously labelled as FA83D. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Constituents: 50% Glycerol, PBS, 0.03% Proclin 300
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Chromosome Structure
    • Chromosome
    • Epigenetics and Nuclear Signaling
    • Chromosome Structure
    • Scaffold Proteins
    • Cancer
    • Cell cycle
    • Cell division

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • K562 whole cell lysate (ab7911)

Applications

Our Abpromise guarantee covers the use of ab236882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Required for proper chromosome congression and alignment during mitosis. Required for targeting KIF22/KID to the spindle microtubules.
  • Sequence similarities

    Belongs to the FAM83 family.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Primarily cytoplasmic during interphase, but beginning in prophase, associates with spindle microtubules, with a clear concentration toward the spindle poles. It persists on spindle microtubules through metaphase and anaphase.
  • Target information above from: UniProt accession Q9H4H8 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 81610 Human
    • SwissProt: Q9H4H8 Human
    • Unigene: 726442 Human
    • Alternative names

      • 2310007D09Rik antibody
      • BB104611 antibody
      • C20orf129 antibody
      • CHICA antibody
      • dJ616B8.3 antibody
      • FA83D antibody
      • FA83D_HUMAN antibody
      • FAM83D antibody
      • Family with sequence similarity 83, member D antibody
      • FLJ38341 antibody
      • MGC92947 antibody
      • Protein FAM83D antibody
      • RGD1565583 antibody
      • RP23-119H5.1 antibody
      • Spindle protein CHICA antibody
      see all

    Images

    • Western blot - Anti-FAM83D antibody (ab236882)
      Western blot - Anti-FAM83D antibody (ab236882)
      All lanes : Anti-FAM83D antibody (ab236882) at 1/500 dilution

      Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
      Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
    • Immunocytochemistry/ Immunofluorescence - Anti-FAM83D antibody (ab236882)
      Immunocytochemistry/ Immunofluorescence - Anti-FAM83D antibody (ab236882)

      HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for FAM83D (green) using ab236882 at a dilution of 1/133 in ICC/IF. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab236882? Please let us know so that we can cite the reference in this datasheet.

    ab236882 has been referenced in 1 publication.

    • Yu C  et al. circFOXM1 promotes proliferation of non-small cell lung carcinoma cells by acting as a ceRNA to upregulate FAM83D. J Exp Clin Cancer Res 39:55 (2020). PubMed: 32228656

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab236882.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.