Anti-FAM83D antibody (ab236882)
Key features and details
- Rabbit polyclonal to FAM83D
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FAM83D antibody -
Description
Rabbit polyclonal to FAM83D -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FAM83D aa 339-470.
Sequence:STPRKADLDPEMPAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAID AATQTEPGEEMPGLSVSEVGTQTSITTACAGTQTAVITRIASSQTTIWSR STTTQTDMDENILFPRGTQSTEGSPVSKMSVS
Database link: Q9H4H8 -
Positive control
- WB: K562 and HEK-293T whole cell lysate. ICC/IF: HepG2 cells.
-
General notes
Previously labelled as FA83D.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol, PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236882 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Required for proper chromosome congression and alignment during mitosis. Required for targeting KIF22/KID to the spindle microtubules. -
Sequence similarities
Belongs to the FAM83 family. -
Cellular localization
Cytoplasm. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Primarily cytoplasmic during interphase, but beginning in prophase, associates with spindle microtubules, with a clear concentration toward the spindle poles. It persists on spindle microtubules through metaphase and anaphase. - Information by UniProt
-
Database links
- Entrez Gene: 81610 Human
- SwissProt: Q9H4H8 Human
- Unigene: 726442 Human
-
Alternative names
- 2310007D09Rik antibody
- BB104611 antibody
- C20orf129 antibody
see all
Images
-
All lanes : Anti-FAM83D antibody (ab236882) at 1/500 dilution
Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution -
HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for FAM83D (green) using ab236882 at a dilution of 1/133 in ICC/IF. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab236882 has been referenced in 1 publication.
- Yu C et al. circFOXM1 promotes proliferation of non-small cell lung carcinoma cells by acting as a ceRNA to upregulate FAM83D. J Exp Clin Cancer Res 39:55 (2020). PubMed: 32228656