Anti-FAM83D antibody (ab236882)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-FAM83D antibody -
Description
Rabbit polyclonal to FAM83D -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FAM83D aa 339-470.
Sequence:STPRKADLDPEMPAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAID AATQTEPGEEMPGLSVSEVGTQTSITTACAGTQTAVITRIASSQTTIWSR STTTQTDMDENILFPRGTQSTEGSPVSKMSVS
Database link: Q9H4H8 -
Positive control
- WB: K562 and HEK-293T whole cell lysate. ICC/IF: HepG2 cells.
-
General notes
Previously labelled as FA83D.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236882 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Required for proper chromosome congression and alignment during mitosis. Required for targeting KIF22/KID to the spindle microtubules. -
Sequence similarities
Belongs to the FAM83 family. -
Cellular localization
Cytoplasm. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Primarily cytoplasmic during interphase, but beginning in prophase, associates with spindle microtubules, with a clear concentration toward the spindle poles. It persists on spindle microtubules through metaphase and anaphase. - Information by UniProt
-
Database links
- Entrez Gene: 81610 Human
- SwissProt: Q9H4H8 Human
- Unigene: 726442 Human
-
Alternative names
- 2310007D09Rik antibody
- BB104611 antibody
- C20orf129 antibody
see all
Images
-
Western blot - Anti-FAM83D antibody (ab236882)All lanes : Anti-FAM83D antibody (ab236882) at 1/500 dilution
Lane 1 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
Lane 2 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution -
Immunocytochemistry/ Immunofluorescence - Anti-FAM83D antibody (ab236882)HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for FAM83D (green) using ab236882 at a dilution of 1/133 in ICC/IF. The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.
References
ab236882 has not yet been referenced specifically in any publications.
