Overview

  • Product name

    Anti-FAM83G/PAWS1 antibody
    See all FAM83G/PAWS1 primary antibodies
  • Description

    Rabbit polyclonal to FAM83G/PAWS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human FAM83G/PAWS1 aa 600-650. The exact sequence is proprietary.
    Sequence:

    SGRGPGPRRPSVASSVSEEYFEVREHSVPLRRRHSEQVANGPTPPPRRQL S


    Database link: A6ND36

  • Positive control

  • General notes

     This product was previously labelled as FAM83G

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    Images

    • Detection of FAM83G/PAWS1 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab186119 at 6 µg/mg lysate for IP. For WB detection an anti-FAM83G/PAWS1 antibody was used at 1µg/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.

    References

    ab186119 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab186119.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up