Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM86A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FAM86A aa 1-330.
    Sequence:

    MAPEENAGTELLLQSFERRFLAARTLRSFPWQSLEAKLRDSSDSELLRDI LHKTVKHPVCVKHPPSVKYARCFLSELIKKHEAVHTEPLDELYEALAETL MAKESTQGHRSYLLPSGGSVTLSESTAIISYGTTGLVTWDAALYLAEWAI ENPAVFTNRTVLELGSGAGLTGLAICKMCRPRAYIFSDCHSRVLEQLRGN VLLNGLSLEADITAKLDSPRVTVAQLDWDVATVHQLSAFQPDVVIAADVL YCPEAIMSLVGVLRRLAACREHQRAPEVYVAFTVRNPETCQLFTTELGRA GIRWEVEPRHEQKLFPYEEHLEMAMLNLTL


    Database link: Q96G04-1

  • Positive control

    • WB: HeLa and HEK-293T whole cell lysate. IHC-P: Small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-FAM86A antibody (ab235380) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human small intestine tissue stained for FAM86A using ab235380 at 1/100 dilution in immunohistochemical analysis.

References

ab235380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up