Overview

  • Product name

  • Description

    Rabbit polyclonal to FAM98A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FAM98A aa 22-109.
    Sequence:

    PLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLEENVQATNSPSE AEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCL


    Database link: Q8NCA5

  • Positive control

    • A431 cells; RT-4, U-251 MG, Human plasma and Human liver lysates; Human salivary gland

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/100 - 1/250. Predicted molecular weight: 55 kDa.

Target

Images

  • Immunofluorescent staining of PFA/Triton X-100 fixed/permeabilized A431 cells labeling FAM98A with ab204083 at 4 µg/ml (green).

  • All lanes : Anti-FAM98A antibody (ab204083) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate

    Developed using the ECL technique.

    Predicted band size: 55 kDa

References

This product has been referenced in:

  • Zheng R  et al. FAM98A promotes proliferation of non-small cell lung cancer cells via the P38-ATF2 signaling pathway. Cancer Manag Res 10:2269-2278 (2018). Read more (PubMed: 30100758) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up