Overview

  • Product name

  • Description

    Rabbit polyclonal to FAN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human FAN1 aa 921-1010.
    Sequence:

    RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRH FKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG


    Database link: Q9Y2M0

  • Positive control

    • ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Nuclease required for maintenance of chromosomal stability. Plays a key role in DNA repair of DNA interstrand cross-links (ICL) by being recruited to sites of DNA damage by monoubiquitinated FANCD2. Specifically involved in repair of ICL-induced DNA breaks by being required for efficient homologous recombination, possibly in the resolution of homologous recombination intermediates. Not involved in DNA double-strand breaks resection. Has both endonuclease activity toward 5'-flaps and 5'-exonuclease activity: may act in concert with the 3'-flap-specific enzymes to unhook the ICL by cleaving the lagging-strand template.
  • Sequence similarities

    Belongs to the FAN1 family.
    Contains 1 UBZ-type zinc finger.
    Contains 1 VRR-NUC domain.
  • Domain

    The UBZ-type zinc finger specifically binds monoubiquitinated FANCD2.
  • Cellular localization

    Nucleus. Localizes at sites of DNA damage following recruitment by monoubiquitinated FANCD2.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6030441H18Rik antibody
    • Coiled coil domain containing protein MTMR15 antibody
    • DKFZp451H236 antibody
    • DKFZp686K16147 antibody
    • FAN1 antibody
    • FAN1_HUMAN antibody
    • FANCD2 and FANCI associated nuclease 1 antibody
    • FANCD2/FANCI associated nuclease 1 antibody
    • FANCD2/FANCI-associated nuclease 1 antibody
    • Fanconi associated nuclease 1 antibody
    • Fanconi-associated nuclease 1 antibody
    • hFAN1 antibody
    • KIAA1018 antibody
    • KMIN antibody
    • MTMR 15 antibody
    • MTMR15 antibody
    • Myotubularin related protein 15 antibody
    • Myotubularin-related protein 15 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FAN1 (green) using ab222206 at 4 µg/ml in ICC/IF.

References

ab222206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up