Overview

  • Product name

  • Description

    Rabbit monoclonal to FAPP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human FAPP2 aa 1-300.
    Sequence:

    MEGVLYKWTNYLSGWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCE IQVHSVDNTRMDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRT QKEKEFAENTENLKTKMSELRLYCDLLVQQVDKTKEVTTTGVSNSEEGID VGTLLKSTCNTFLKTLEECMQIANAAFTSELLYRTPPGSPQLAMLKSSKM KHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEI DCSISSEENTDDNITVQGEIRKEDGMENLKNHDNNLTQSGSDSSCSPECL


    Database link: Q96JA3

  • Positive control

    • WB: Mouse brain lysate. IHC-P: Human placenta and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 58 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Involved in TGN-to-plasma membrane transport and in the formation of post-Golgi constitutive carriers. May play a role in ensuring the coordination of the budding and the fission reactions.
  • Tissue specificity

    Expressed in kidney cell lines.
  • Sequence similarities

    Contains 1 PH domain.
  • Domain

    Interacts with PIP and ARF via plekstrin homology domain.
  • Cellular localization

    Cytoplasm. Localized to perinuclear structures in the trans-Golgi network.
  • Information by UniProt
  • Database links

  • Alternative names

    • FAPP-2 antibody
    • FAPP2 antibody
    • hFAPP2 antibody
    • MGC3358 antibody
    • PH domain-containing family A member 8 antibody
    • Phosphatidylinositol-four-phosphate adapter protein 2 antibody
    • Phosphoinositide binding specificmember 8 antibody
    • Phosphoinositol 4 phosphate adaptor protein 2 antibody
    • Phosphoinositol 4-phosphate adapter protein 2 antibody
    • PKHA8_HUMAN antibody
    • Pleckstrin homology domain containing A8 antibody
    • Pleckstrin homology domain containing family A (Phosphoinositide binding specific) member 8 antibody
    • Pleckstrin homology domain containing family A antibody
    • Pleckstrin homology domain-containing family A member 8 antibody
    • Plekha8 antibody
    • PLEKHA8 protein antibody
    • Serologically defined breast cancer antigen NY-BR-86 antibody
    see all

Images

  • Anti-FAPP2 antibody (ab235300) at 1/500 dilution + Mouse brain lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 58 kDa

  • Paraffin-embedded human placenta tissue stained for FAPP2 using ab235300 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for FAPP2 using ab235300 at 1/100 dilution in immunohistochemical analysis.

References

This product has been referenced in:

  • Bhatt JM  et al. Promiscuity of the catalytic Sec7 domain within the guanine nucleotide exchange factor GBF1 in ARF activation, Golgi homeostasis, and effector recruitment. Mol Biol Cell 30:1523-1535 (2019). Read more (PubMed: 30943106) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up