Overview

  • Product name

  • Description

    Rabbit polyclonal to FARS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Rat FARS2 aa 1-472. Expressed in E.coli.
    Sequence:

    MVCLAFIRAAHEHLYLVRKVSHVCRCHQHRAWGSRPAASQFAVQGAPGRV LELLGKSYPQDDHTNLTQKVLSKVGRNLHNQKFHPLWLIKERVKEHFYQQ YMGRSRTPLFSVYDQLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRGH MLRAHTSAHQWDLLHAGLNAFLVVGDVYRRDQIDSQHYPVFHQLEGVRLF SKHELFAGVKDGESLQLFEESSRSAHKQETHTMEAVKLVEFDLKQVLTRL VTHLFGDGLEVRWVDCYFPFTHPSFEMEINFRGEWLEVLGCGVMEQQLVN SAGAQDRIGWAFGLGLERLAMVLYDIPDIRLFWSEDERFLKQFRLSDINQ SVKFQRWFFQEERATGIQRKMGRQLCPFSKYPAVFNDISFWLPSENYTEN DFYDIVRTVGGDLVEKVDLIDKFEHPKTHRTSHCYRITYRHMERTLSQRE VSSVHQAVQEAAVQLLGVEGRF


    Database link: Q6AYQ3

  • Positive control

    • WB: Recombinant rat FARS2; HeLa, Jurkat and HepG2 whole cell lysate (ab7900). IHC-P: Rat stomach and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 52 kDa.

Target

  • Function

    Catalyzes direct attachment of p-Tyr (Tyr) to tRNAPhe. Permits also, with a lower efficiency, the attachment of m-Tyr to tRNAPhe, thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins.
  • Sequence similarities

    Belongs to the class-II aminoacyl-tRNA synthetase family.
    Contains 1 FDX-ACB domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ236A3.1 (phenylalanine tRNA synthetase) antibody
    • dJ520B18.2 (FARS1 (phenylalanine tRNA synthetase)) antibody
    • FARS1 antibody
    • Fars2 antibody
    • HSPC320 antibody
    • Phenylalanine translase antibody
    • Phenylalanine tRNA ligase 2, mitochondrial antibody
    • Phenylalanine tRNA ligase antibody
    • Phenylalanine tRNA synthetase 1 (mitochondrial) antibody
    • Phenylalanine tRNA synthetase 2 (mitochondrial) antibody
    • Phenylalanine--tRNA ligase antibody
    • Phenylalanyl tRNA synthetase 2 antibody
    • Phenylalanyl-tRNA synthetase, mitochondrial antibody
    • PheRS antibody
    • SYFM_HUMAN antibody
    see all

Images

  • Anti-FARS2 antibody (ab231190) at 2 µg/ml + Recombinant rat FARS2 protein

    Predicted band size: 52 kDa

  • Anti-FARS2 antibody (ab231190) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 52 kDa

  • Anti-FARS2 antibody (ab231190) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Predicted band size: 52 kDa

  • Anti-FARS2 antibody (ab231190) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 52 kDa

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for FARS2 using ab231190 at 20 mg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for FARS2 using ab231190 at 20 mg/ml in immunohistochemical analysis. DAB staining.

References

ab231190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up