Overview

  • Product name
  • Description
    Rabbit polyclonal to FARSLB
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FARSLB aa 426-572.
    Sequence:

    KLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLF EISDIVIKDSNTDVGAKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVP PGEDKGGYVIKASEGPAFFPGRCAEIFARGQSVGKLGVLHPDVITKF


    Database link: BC017783

  • Positive control
    • PC-3 cell lysate, Human fetal kidney tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 66 kDa.

Target

  • Sequence similarities
    Belongs to the phenylalanyl-tRNA synthetase beta chain family. Type 2 subfamily.
    Contains 1 B5 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • C76708 antibody
    • Farsa antibody
    • FARSB antibody
    • Farsl antibody
    • Farslb antibody
    • FRSB antibody
    • HSPC173 antibody
    • PheHB antibody
    • Phenylalanine tRNA ligase beta subunit antibody
    • phenylalanine tRNA ligase 1, beta, cytoplasmic antibody
    • Phenylalanine tRNA ligase beta chain antibody
    • Phenylalanine--tRNA ligase beta chain antibody
    • phenylalanine-tRNA synthetase-like, beta subunit antibody
    • Phenylalanyl tRNA synthetase beta chain antibody
    • Phenylalanyl-tRNA synthetase beta chain antibody
    • phenylalanyl-tRNA synthetase beta-subunit antibody
    • phenylalanyl-tRNA synthetase-like, beta subunit antibody
    • PheRS antibody
    • SYFB_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal kidney tissue labeling FARSLB with ab177202 at 1/100 dilution.

  • Anti-FARSLB antibody (ab177202) at 1/500 dilution + PC-3 cell lysate

    Predicted band size: 66 kDa

References

ab177202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up