Overview

  • Product name

  • Description

    Rabbit polyclonal to Fas Ligand
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Human, Rhesus monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rhesus monkey Fas Ligand aa 102-280. Expressed in E. coli.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSQLFHLQKELAELREST SQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGI VLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKY PQDLVMMEGKMMSYCTTGQMWAHSSYLGAVFNLTSADHLYVNVSELSLVN FEESQTFFGLYKL


    Database link: P63307

  • Positive control

    • WB: Rat testis, uterus and cerebrum lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function

    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in disease

    Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALPS1B antibody
    • Apoptosis (APO 1) antigen ligand 1 antibody
    • Apoptosis antigen ligand 1 antibody
    • Apoptosis antigen ligand antibody
    • APT1LG1 antibody
    • APTL antibody
    • CD178 antibody
    • CD178 antigen antibody
    • CD95 ligand antibody
    • CD95-L antibody
    • CD95L antibody
    • CD95L protein antibody
    • Fas antigen ligand antibody
    • Fas L antibody
    • Fas ligand (TNF superfamily member 6) antibody
    • Fas ligand antibody
    • FASL antibody
    • Fasl Fas ligand (TNF superfamily member 6) antibody
    • FASLG antibody
    • Generalized lymphoproliferative disease antibody
    • Gld antibody
    • soluble form antibody
    • TNFL6_HUMAN antibody
    • TNFSF6 antibody
    • Tumor necrosis factor (ligand) superfamily member 6 antibody
    • Tumor necrosis factor ligand superfamily member 6 antibody
    see all

Images

  • Anti-Fas Ligand antibody (ab231011) at 5 µg/ml + Rat uterus lysate

    Predicted band size: 31 kDa

  • Anti-Fas Ligand antibody (ab231011) at 5 µg/ml + Rat cerebrum lysate

    Predicted band size: 31 kDa

  • Anti-Fas Ligand antibody (ab231011) at 5 µg/ml + Rat testis lysate

    Predicted band size: 31 kDa

  • Anti-Fas Ligand antibody (ab231011) at 5 µg/ml + Recombinant simian Fas Ligand protein

    Predicted band size: 31 kDa

References

ab231011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up