Overview

  • Product name

  • Description

    Rabbit polyclonal to Fascin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Fascin 2 aa 8-258. (Expressed in E.coli).
    Sequence:

    QVLKIQFGLVNDTDRYLTAESFGFKVNASAPSLKRKQTWVLEPDPGQGTA VLLRSSHLGRYLSAEEDGRVACEAEQPGRDCRFLVLPQPDGRWVLRSEPH GRFFGGTEDQLSCFATAVSPAELWTVHLAIHPQAHLLSVSRRRYVHLCPR EDEMAADGDKPWGVDALLTLIFRSRRYCLKSCDSRYLRSDGRLVWEPEPR ACYTLEFKAGKLAFKDCDGHYLAPVGPAGTLKAGRNTRPGKDELFDLEES H


    Database link: O14926

  • Positive control

    • WB: Recombinant human Fascin 2 protein; Human placenta lysate. IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 mg/ml. Predicted molecular weight: 55 kDa.
IHC-P Use a concentration of 5 - 20 mg/ml.

Target

  • Function

    Acts as an actin bundling protein. May play a pivotal role in photoreceptor cell-specific events, such as disk morphogenesis.
  • Tissue specificity

    Localized specifically in the outer and inner segments of the photoreceptor cells in the retina.
  • Involvement in disease

    Defects in FSCN2 are the cause of retinitis pigmentosa type 30 (RP30) [MIM:607921]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP30 inheritance is autosomal dominant.
  • Sequence similarities

    Belongs to the fascin family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > stereocilium.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fascin homolog 2, actin bundling protein, retinal Strongylocentrotus purpuratus antibody
    • Fascin Strongylocentrotus purpuratus homolog 2 actin bundling protein, retinal antibody
    • Fascin-2 antibody
    • FSCN2 antibody
    • FSCN2_HUMAN antibody
    • Retinal fascin antibody
    • RFSN antibody
    • RP30 antibody
    see all

Images

  • Anti-Fascin 2 antibody (ab232768) at 1 µg/ml + Recombinant human Fascin 2 protein

    Predicted band size: 55 kDa

  • Anti-Fascin 2 antibody (ab232768) at 1 µg + Human placenta lysate

    Predicted band size: 55 kDa

  • Formalin-fixed, paraffin-embedded human brain tissue stained for Fascin 2 using ab232768 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up