Overview

  • Product name

    Anti-Fascin antibody [FSCN1/417]
    See all Fascin primary antibodies
  • Description

    Mouse monoclonal [FSCN1/417] to Fascin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human Fascin aa 2-493.
    Sequence:

    TANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQP PDEAGSAAVC LRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDG RWSLQSEAHRRYFGGTEDRLSC FAQTVSPAEKWSVHIAMHPQVNIYSV TRKRYAHLSARPADEIAVDRDVPWGVDSLITLAF QDQRYSVQTADHRF LRHDGRLVARPEPATGYTLEFRSGKVAFRDCEGRYLAPSGPSGTLK AG KATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQET FQLEIDRD TKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWR DRRITLRASNGKFVTSKKNG QLAASVETAGDSELFLMKLINRPIIVFR GEHGFIGCRKVTGTLDANRSSYDVFQLEFNDG AYNIKDSTGKYWTVGS DSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKAS AETV DPASLWEY


    Database link: Q16658

  • Positive control

    • Human Hodgkin's lymphoma, ovarian carcinoma and testicular carcinoma tissues; HeLa cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, 99% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    ab220195 was purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    FSCN1/417
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 54 kDa.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. Plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. Important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the fascin family.
  • Domain

    Composed of four beta-trefoil domains.
  • Post-translational
    modifications

    Phosphorylation on Ser-39 inhibits the actin-binding ability of fascin.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > filopodium. Cell projection > invadopodium.
  • Information by UniProt
  • Database links

  • Alternative names

    • 55 kDa actin bundling protein antibody
    • 55 kDa actin-bundling protein antibody
    • Actin bundling protein antibody
    • actin bundling protein, 55-KD antibody
    • FAN 1 antibody
    • FAN1 antibody
    • Fascin 1 antibody
    • Fascin actin bundling protein 1 antibody
    • Fascin antibody
    • Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody
    • Fascin homolog 1 antibody
    • Fascin, sea urchin, homolog of, 1 antibody
    • Fascin1 antibody
    • FLJ38511 antibody
    • FSCN 1 antibody
    • FSCN1 antibody
    • FSCN1_HUMAN antibody
    • HSN antibody
    • p55 antibody
    • Singed (Drosophila) like (sea urchin fascin homolog like) antibody
    • Singed drosophila homolog like antibody
    • Singed like (fascin homolog sea urchin) (Drosophila) antibody
    • Singed like (fascin homolog sea urchin) antibody
    • Singed like protein antibody
    • Singed, drosophila, homolog of antibody
    • Singed-like protein antibody
    • SNL antibody
    • Strongylocentrotus purpuratus antibody
    see all

Images

  • Anti-Fascin antibody [FSCN1/417] (ab220195) at 1 µg/ml + HeLa cell lysate

    Predicted band size: 54 kDa

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human testicular carcinoma tissue labeling Fascin with ab220195 at 1 μg/ml dilution.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human ovarian carcinoma tissue labeling Fascin with ab220195 at 1 μg/ml dilution.

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human Hodgkin's lymphoma tissue labeling Fascin with ab220195 at 1 μg/ml dilution.

References

This product has been referenced in:

  • Chen Z  et al. MicroRNA-145 regulates immune cytokines via targeting FSCN1 in Staphylococcus aureus-induced mastitis in dairy cows. Reprod Domest Anim 54:882-891 (2019). Read more (PubMed: 30974481) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up