Overview

  • Product name

  • Description

    Rabbit polyclonal to FASTK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human FASTK aa 360-549.
    Sequence:

    LLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGL RQLLGEEKYRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSC PQGQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMG YQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG


    Database link: Q14296-1

  • Positive control

    • IHC-P: Human liver and brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab225955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Phosphorylates the splicing regulator TIA1, thereby promoting the inclusion of FAS exon 6, which leads to an mRNA encoding a pro-apoptotic form of the receptor.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the FAST protein kinase family.
    Contains 1 RAP domain.
  • Post-translational
    modifications

    Autophosphorylated on serine/threonine residues. Activated by dephosphorylation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fas activated serine threonine kinase antibody
    • Fas-activated serine/threonine kinase antibody
    • FAST antibody
    • FAST kinase antibody
    • FASTK antibody
    • FASTK_HUMAN antibody
    • FLJ13079 antibody
    see all

Images

  • Paraffin embedded human brain tissue stained for FASTK with ab225955 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human liver tissue stained for FASTK with ab225955 (1/100 dilution) in immunohistochemical analysis.

References

ab225955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up