Overview

  • Product name

  • Description

    Rabbit polyclonal to FASTKD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FASTKD2 aa 117-203.
    Sequence:

    KQSLVPVDKSDDELKKVNLNHEVSNEDVLTKETKPNRISSRKLSEECNSL SDVLDAFSKAPTFPSSNYFTAMWTIAKRLSDDQKRFE


    Database link: Q9NYY8

  • Positive control

    • WB: Rat and mouse heart lysate. IHC-P: Human spleen and heart tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/300.
WB 1/500 - 1/5000. Predicted molecular weight: 81, 75 kDa.

Target

Images

  • All lanes : Anti-FASTKD2 antibody (ab235113) at 1/500 dilution

    Lane 1 : Rat heart lysate
    Lane 2 : Mouse heart lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 81, 75 kDa

  • Paraffin-embedded human spleen tissue stained for FASTKD2 using ab235113 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

  • Paraffin-embedded human heart tissue stained for FASTKD2 using ab235113 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up