Overview

  • Product name

  • Description

    Rabbit polyclonal to FAT10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FAT10 aa 1-165.
    Sequence:

    MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVL LLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAK RHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI RKGNLLFLACYCIGG


    Database link: O15205

Properties

Applications

Our Abpromise guarantee covers the use of ab192581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 18 kDa.

Target

  • Function

    Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1L-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN).
  • Tissue specificity

    Constitutively expressed in mature dendritic cells and B cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland.
  • Sequence similarities

    Contains 2 ubiquitin-like domains.
  • Post-translational
    modifications

    Can be acetylated.
  • Cellular localization

    Nucleus. Cytoplasm. Accumulates in aggresomes under proteasome inhibition conditions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Diubiquitin antibody
    • FAT10 antibody
    • GABBR1 antibody
    • UBD 3 antibody
    • Ubd antibody
    • UBD_HUMAN antibody
    • Ubiquitin D antibody
    • Ubiquitin like protein FAT10 antibody
    • Ubiquitin-like protein FAT10 antibody
    see all

References

This product has been referenced in:

  • Li C  et al. Human HLA-F adjacent transcript 10 promotes the formation of cancer initiating cells and cisplatin resistance in bladder cancer. Mol Med Rep 18:308-314 (2018). Read more (PubMed: 29749526) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up