Overview

  • Product name

  • Description

    Rabbit polyclonal to FATE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FATE1 aa 79-158.
    Sequence:

    GSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEE FNVLEMEVMRRQLYAVNRRLRALEEQGATW


    Database link: Q969F0

  • Positive control

    • IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223720 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Testis-specific in fetus (aged from 6 to 11 weeks). In adult, expressed predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancer/testis antigen 43 antibody
    • CT43 antibody
    • FATE antibody
    • FATE1 antibody
    • FATE1_HUMAN antibody
    • fetal and adult testis expressed 1 antibody
    • fetal and adult testis expressed transcript protein antibody
    • Fetal and adult testis-expressed transcript protein antibody
    • Protein BJ HCC 2 antibody
    • Tumor antigen BJ-HCC-2 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for FATE1 using ab223720 at 1/1000 dilution in immunohistochemical analysis.

References

ab223720 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223720.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up