Overview

  • Product name

  • Description

    Rabbit polyclonal to FAT/FAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Dog
  • Immunogen

    Synthetic peptide within Human FAT/FAT1 aa 4450-4500. The exact sequence is proprietary. NP_005236.2
    Sequence:

    PLPPEFSNQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPLDMS E


    Database link: Q14517

  • Positive control

    • HeLa, 293T, Jurkat, NIH 3T3 and TCMK-1 whole cell lysates
  • General notes

     This product was previously labelled as FAT

     

Properties

Applications

Our Abpromise guarantee covers the use of ab190242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 506 kDa.

Target

  • Function

    Plays an essential role for cellular polarization, directed cell migration and modulating cell-cell contact.
  • Tissue specificity

    Expressed in many epithelial and some endothelial and smooth muscle cells.
  • Sequence similarities

    Contains 33 cadherin domains.
    Contains 5 EGF-like domains.
    Contains 1 laminin G-like domain.
  • Domain

    A PTB-like motif (DNXYH sequence) is required for the targeting to the leading edge. This motif represents a minimal protein-protein interaction core motif that is not regulated by tyrosine phosphorylation.
  • Post-translational
    modifications

    Undergoes proteolytic cleavage. The extracellular domain is cleaved off and the cytoplasmic domain (about 400 AA) shuttles to the nucleus.
  • Cellular localization

    Cell membrane. Nucleus. Cytoplasm > perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cadherin family member 7 antibody
    • Cadherin family member 7 precursor antibody
    • Cadherin ME5 antibody
    • Cadherin related tumor suppressor antibody
    • Cadherin related tumor suppressor homolog antibody
    • Cadherin related tumor suppressor homolog precursor antibody
    • Cadherin related tumor suppressor homolog precursor (FAT protein homolog) antibody
    • Cadherin-related tumor suppressor homolog antibody
    • CDHF 7 antibody
    • CDHF7 antibody
    • FAT 1 antibody
    • FAT tumor suppressor 1 antibody
    • FAT tumor suppressor homolog 1 antibody
    • FAT1 antibody
    • FAT1_HUMAN antibody
    • hFat 1 antibody
    • hFAT antibody
    • hFat1 antibody
    • Homolog of Drosophila FAT protein antibody
    • Homolog of Drosophila FAT protein precursor antibody
    • Homolog of Drosophila tumor suppressor FAT precursor antibody
    • ME 5 antibody
    • ME5 antibody
    • nuclear form antibody
    • Protein fat homolog antibody
    • Protocadherin Fat 1 antibody
    see all

Images

  • All lanes : Anti-FAT/FAT1 antibody (ab190242) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 506 kDa


    Exposure time: 3 minutes

References

This product has been referenced in:

  • Lahrouchi N  et al. Homozygous frameshift mutations in FAT1 cause a syndrome characterized by colobomatous-microphthalmia, ptosis, nephropathy and syndactyly. Nat Commun 10:1180 (2019). Read more (PubMed: 30862798) »
  • Hu X  et al. FAT1 inhibits cell migration and invasion by affecting cellular mechanical properties in esophageal squamous cell carcinoma. Oncol Rep 39:2136-2146 (2018). Read more (PubMed: 29565465) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up