Overview

  • Product name
    Anti-FATP2 antibody [6B3A9]
    See all FATP2 primary antibodies
  • Description
    Mouse monoclonal [6B3A9] to FATP2
  • Host species
    Mouse
  • Tested applications
    Suitable for: ELISA, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FATP2 aa 346-405. Expressed in E. Coli.
    Sequence:

    WRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYD LIKYDVEKDE


    Database link: O14975

  • Positive control
    • Human FATP2 recombinant protein; FATP2 (aa: 346-405)-hIgGFc transfected HEK293 cell lysate; Human liver and esophageal cancer tissues

Properties

Applications

Our Abpromise guarantee covers the use of ab175373 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 70 kDa.

Target

  • Function
    Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes.
  • Tissue specificity
    Expressed in liver, kidney, placenta and pancreas.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Endoplasmic reticulum membrane. Peroxisome membrane. Peripheral membrane associated with the lumenal side of peroxisomes.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACSVL1 antibody
    • FACVL1 antibody
    • FATP 2 antibody
    • FATP-2 antibody
    • FATP2 antibody
    • Fatty acid coenzyme A ligase, very long chain 1 antibody
    • Fatty acid transport protein 2 antibody
    • Fatty-acid-coenzyme A ligase antibody
    • hFACVL1 antibody
    • HsT17226 antibody
    • Long chain fatty acid CoA ligase antibody
    • Long-chain-fatty-acid--CoA ligase antibody
    • S27A2_HUMAN antibody
    • Slc27a2 antibody
    • Solute carrier family 27 (fatty acid transporter), member 2 antibody
    • Solute carrier family 27 member 2 antibody
    • THCA CoA ligase antibody
    • THCA-CoA ligase antibody
    • Very long chain acyl CoA synthetase antibody
    • Very long chain fatty acid CoA ligase antibody
    • Very long chain fatty acid coenzyme A ligase 1 antibody
    • very long-chain 1 antibody
    • Very long-chain acyl-CoA synthetase antibody
    • Very long-chain-fatty-acid-CoA ligase antibody
    • VLACS antibody
    • VLCS antibody
    see all

Images

  • All lanes : Anti-FATP2 antibody [6B3A9] (ab175373) at 1/500 dilution

    Lane 1 : Non transfected HEK293 cell lysate
    Lane 2 : FATP2 (aa: 346-405)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 70 kDa



    Expected MW is 32.4 kDa

  • Anti-FATP2 antibody [6B3A9] (ab175373) at 1/500 dilution + Human FATP2 recombinant protein

    Predicted band size: 70 kDa



    Expected MW is 32.4 kDa

  • Immunohistochemical analysis of paraffin-embedded Human esophageal cancer tissue labeling FATP2 using ab175373 at 1/200 dilution, followed by with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling FATP2 using ab175373 at 1/200 dilution, followed by with DAB staining.

References

ab175373 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175373.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up