Anti-FATS antibody (ab122497)
Key features and details
- Rabbit polyclonal to FATS
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FATS antibody -
Description
Rabbit polyclonal to FATS -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FATS aa 169-262.
Sequence:AEDTLFQAPPALANGAHPGRHQRSFACTEFSRNSSVVRLKVPEAHTGLCE RRKYWVTHADDKETSFSPDTPLSGKSPLVFSSCVHLRVSQQCPD
-
Positive control
- Human kidney tissue; RT-4 and U-251 MG cell lysate; Human Liver and Tonsil tissue lysate.
-
General notes
This product was previously labelled as C10orf90
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab122497 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
|
IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | 1/250 - 1/500. |
Target
- Information by UniProt
-
Database links
- Entrez Gene: 118611 Human
- SwissProt: Q96M02 Human
- Unigene: 587663 Human
-
Alternative names
- bA422P15.2 antibody
- C10orf90 antibody
- Chromosome 10 open reading frame 90 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-FATS antibody (ab122497)
ab122497 at 1/425 staining FATS in Paraffin Embedded Human kidney tissue.
-
Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm. Recommended concentration of ab122497 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
All lanes : Anti-FATS antibody (ab122497) at 1/250 dilution
Lane 1 : RT-4 lysate
Lane 2 : U-251 MG lysate
Lane 3 : Human Plasma
Lane 4 : Human Liver lysate
Lane 5 : Human Tonsil lysate
Developed using the ECL technique.
Protocols
Datasheets and documents
References (1)
ab122497 has been referenced in 1 publication.
- Song F et al. A functional genetic variant in fragile-site gene FATS modulates the risk of breast cancer in triparous women. BMC Cancer 15:559 (2015). IHC . PubMed: 26223354