Overview

  • Product name

    Anti-FAU / 40S ribosomal protein S30 antibody
    See all FAU / 40S ribosomal protein S30 primary antibodies
  • Description

    Rabbit polyclonal to FAU / 40S ribosomal protein S30
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human FAU/ 40S ribosomal protein S30 aa 85-134 (internal sequence).
    Sequence:

    VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS


    Database link: P62861

  • Positive control

    • Recombinant Human FAU / 40S ribosomal protein S30 protein (ab114756) can be used as a positive control in WB. 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab81442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Images

  • Anti-FAU / 40S ribosomal protein S30 antibody (ab81442) at 1 µg/ml + MCF7 cell lysate

    Predicted band size: 14 kDa

  • Anti-FAU / 40S ribosomal protein S30 antibody (ab81442) at 1 µg/ml + Jurkat cell lysate

    Predicted band size: 14 kDa

  • Anti-FAU / 40S ribosomal protein S30 antibody (ab81442) at 1 µg/ml + HeLa cell lysate

    Predicted band size: 14 kDa

  • Anti-FAU / 40S ribosomal protein S30 antibody (ab81442) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 14 kDa
    Observed band size: 14 kDa



    Gel concentration 10-20%

References

ab81442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (U2OS)
Gel Running Conditions
Reduced Denaturing (4-12% bis-Tris)
Loading amount
7.5 µg
Specification
U2OS
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jul 23 2013

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (U20S)
Permeabilization
Yes - Triton-X
Specification
U20S
Blocking step
BSA as blocking agent for 15 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jul 02 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up