Overview

  • Product name

  • Description

    Rabbit polyclonal to FBP17
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FBP17.
    Sequence:

    DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLG ATPEDFSNLPPEQ

  • Positive control

    • IHC-P: Human lymph node tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May act as a link between RND2 signaling and regulation of the actin cytoskeleton (By similarity). Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during endocytosis. Binds to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promotes membrane invagination and the formation of tubules. Also enhances actin polymerization via the recruitment of WASL/N-WASP, which in turn activates the Arp2/3 complex. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. May be required for the lysosomal retention of FASLG/FASL.
  • Tissue specificity

    Very highly expressed in the epithelial cells of the gastrointestinal tract, respiratory, reproductive and urinary systems. Also highly expressed in brown adipose tissue, cardiomyocytes, enteric ganglia and glucagon producing cells of the pancreas. Expressed in germ cells of the testis and all regions of the brain.
  • Involvement in disease

    Note=A chromosomal aberration involving FNBP1 is found in acute leukemias. Translocation t(9;11)(q34;q23) with MLL. The relatively low incidence of the MLL-FNBP1 fusion protein in acute leukemia may reflect the marginal capacity of this fusion protein to induce cellular transformation.
  • Sequence similarities

    Belongs to the FNBP1 family.
    Contains 1 FCH domain.
    Contains 1 REM (Hr1) repeat.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Lysosome. Cytoplasmic vesicle. Cell membrane. Enriched in cortical regions coincident with F-actin. Also localizes to endocytic vesicles and lysosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • FBP1 antibody
    • FBP17 antibody
    • Fnbp1 antibody
    • FNBP1_HUMAN antibody
    • Formin binding protein 1 antibody
    • Formin binding protein 17 antibody
    • Formin-binding protein 1 antibody
    • Formin-binding protein 17 antibody
    • hFBP17 antibody
    • KIAA0554 antibody
    • MGC126804 antibody
    see all

Images

  • Paraffin-embedded human lymph node tissue stained for FBP17 using ab246920 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human colon tissue stained for FBP17 using ab246920 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for FBP17 using ab246920 at 1/50 dilution in immunohistochemical analysis.
  • Paraffin-embedded human skeletal muscle tissue stained for FBP17 using ab246920 at 1/50 dilution in immunohistochemical analysis. Low expression as expected.

References

ab246920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up