Overview

  • Product name

  • Description

    Rabbit polyclonal to FBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Immunogen

    Recombinant fragment corresponding to Human FBP2 aa 283-339.
    Sequence:

    NPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCV QKNQAGS


    Database link: O00757

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations and probably participates in glycogen synthesis from carbohydrate precursors, such as lactate.
  • Tissue specificity

    Expressed in skeletal muscle (at protein level).
  • Pathway

    Carbohydrate biosynthesis; gluconeogenesis.
  • Sequence similarities

    Belongs to the FBPase class 1 family.
  • Cellular localization

    Cell junction. Cytoplasm. Nucleus. Cytoplasm, myofibril, sarcomere, Z line. In neonatal cardiomyocytes, distributed throughout the cytosol, accumulating in the intercalated disks which occur at the Z line of cardiomyocytes and connect adjacent cells, and also located in the nucleus; dissociates from the Z line following an increase in cytosolic Ca(2+) concentration (By similarity). In muscle precursor cells, localizes predominantly to the nucleus and to a lesser extent to the cytoplasm at the proliferative phase, while mainly localizing to the cytoplasm at the differentiation phase (By similarity). Colocalizes with ALDOA and alpha-actinin on both sides of the Z line of skeletal muscle; dissociates rapidly from the Z line following an increase in cytosolic Ca(2+) concentration.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6-bisphosphatase isozyme 2 antibody
    • 6-bisphosphate 1-phosphohydrolase 2 antibody
    • D fructose 1 6 bisphosphate 1 phosphohydrolase 2 antibody
    • D-fructose-1 antibody
    • F16P2_HUMAN antibody
    • FBP 2 antibody
    • fbp2 antibody
    • FBPase 2 antibody
    • FBPase antibody
    • fructose 1 6 bisphosphatase 2 antibody
    • Fructose 1 6 bisphosphatase isozyme 2 antibody
    • Fructose-1 antibody
    • Hexosediphosphatase antibody
    • MGC142192 antibody
    • Muscle FBPase antibody
    • Muscle fructose bisphosphatase antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for FBP2 using ab236660 at a dilution of 1/166 in ICC/IF.
    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up