Overview

  • Product name

    Anti-FBSH antibody
  • Description

    Rabbit polyclonal to FBSH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human FBSH aa 1-250. Expressed in E. coli.
    Sequence:

    MFEKYPGKMEGLFRHNPYTAFPPAVPGLPPGLPPAVSFGSLQGAFQPKST NPELPPRLGPVPSGLSQKGTQIPDHFRPPLRKPGKWCAMHVRVAYMILRH QEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAA ANPFTAAPGAHGPFLSPSTHIDPFGRPTSFASLAALSNGAFGGLGSPTFN SGAVFAQKESPGAPPAFASPPDPWGRLHRSPLTFPAWVRPPEAARTPGSD


    Database link: Q9HAH7

  • Positive control

    • WB: Recombinant human FBSH; MCF7 cell lysate; mouse kidney tissue lysate. IHC-P: Human liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 48 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for FBSH with ab230982 at 20 μg/ml in immunohistochemical analysis.

  • Anti-FBSH antibody (ab230982) at 2 µg/ml + MCF7 (Human breast adenocarcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 48 kDa

  • Anti-FBSH antibody (ab230982) at 2 µg/ml + Mouse kidney tissue lysate

    Developed using the ECL technique.

    Predicted band size: 48 kDa

  • Anti-FBSH antibody (ab230982) at 2 µg/ml + Recombinant human FBSH

    Developed using the ECL technique.

    Predicted band size: 48 kDa

References

ab230982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up