Overview

  • Product name

  • Description

    Rabbit polyclonal to FBW2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human FBW2 aa 396-445 (internal sequence).
    Sequence:

    SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

  • Positive control

    • Jurkat whole cell lysate (ab7899).
  • General notes

     This product was previously labelled as FbxW2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab83467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

Images

  • Anti-FBW2 antibody (ab83467) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa
    Observed band size: 52 kDa
    Additional bands at: 34 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration: 12%

References

This product has been referenced in:

  • Yang F  et al. FBXW2 suppresses migration and invasion of lung cancer cells via promoting ß-catenin ubiquitylation and degradation. Nat Commun 10:1382 (2019). Read more (PubMed: 30918250) »
  • Xu J  et al. The ß-TrCP-FBXW2-SKP2 axis regulates lung cancer cell growth with FBXW2 acting as a tumour suppressor. Nat Commun 8:14002 (2017). IHC . Read more (PubMed: 28090088) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up