Overview

  • Product name

    Anti-FBXL15 antibody - N-terminal
  • Description

    Rabbit polyclonal to FBXL15 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Goat, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human FBXL15 aa 3-52 (N terminal). The exact sequence is proprietary. NP_077302.
    Sequence:

    PPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFR


    Database link: Q9H469

  • Positive control

    • Human fetal lung tissue lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab178055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa.

Target

Images

  • Anti-FBXL15 antibody - N-terminal (ab178055) at 1 µg/ml + Human fetal lung tissue lysate at 10 µg

    Predicted band size: 33 kDa

References

ab178055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up