Overview

  • Product name

    Anti-FBXL22 antibody
  • Description

    Rabbit polyclonal to FBXL22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human FBXL22 aa 123-229.
    Sequence:

    RSPRRREAPAPSSGTPIAVGPKSPRWGGPDHSEFADLRSGVTGARAAARR GLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHR AAPPCGF


    Database link: Q6P050

  • Positive control

    • WB: Mouse brain lysate; human placenta lysate. IHC-P: Human pancreatic cancer tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity>95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab223059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 27 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    This gene encodes a member of the F-box protein family. This F-box protein interacts with S-phase kinase-associated protein 1A and cullin in order to form SCF complexes which function as ubiquitin ligases.
  • Database links

  • Alternative names

    • F box and leucine rich repeat protein 22 antibody
    • F box/LRR repeat protein 22 antibody
    • Fbl22 antibody
    • FLJ39626 antibody

Images

  • All lanes : Anti-FBXL22 antibody (ab223059) at 1/1000 dilution

    Lane 1 : Mouse brain lysate
    Lane 2 : Human placenta lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa

  • Paraffin embedded human pancreatic cancer tissue stained for FBXL22 with ab223059 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for FBXL22 (green) using ab223059 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab223059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up