Overview

  • Product name

    Anti-FbxL7 antibody
  • Description

    Rabbit polyclonal to FbxL7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to Human FbxL7 aa 101-150.
    Sequence:

    IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD

  • Positive control

    • HepG2 cell lysate and human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab59149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 50 kDa (predicted molecular weight: 55 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay:1/312500.

Target

  • Function

    Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 11 LRR (leucine-rich) repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • AL023057 antibody
    • D230018M15Rik antibody
    • F Box and Leucine Rich Repeat Protein 7 antibody
    • F box protein FBL6/FBL7 antibody
    • F box/LRR-repeat protein 7 antibody
    • F-box and leucine-rich repeat protein 7 antibody
    • F-box protein FBL6/FBL7 antibody
    • F-box/LRR-repeat protein 7 antibody
    • FBL 6 antibody
    • FBL 7 antibody
    • FBL6 antibody
    • FBL7 antibody
    • FBXL 7 antibody
    • FBXL7 antibody
    • FBXL7_HUMAN antibody
    • FLJ11609 antibody
    • KIAA0840 antibody
    • MGC102204 antibody
    see all

Images

  • Anti-FbxL7 antibody (ab59149) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 55 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling FbxL7 with ab59149 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the renal tubule. Magnification: 400X.

References

ab59149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton X-100
Specification
HeLa
Fixative
Paraformaldehyde

Dr. Kirk Mcmanus

Verified customer

Submitted Aug 14 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
No
Specification
HeLa
Fixative
Methanol

Dr. Kirk Mcmanus

Verified customer

Submitted Jan 04 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up