Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXO11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human FBXO11 aa 85-127 (internal sequence) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTT


    Database link: Q86XK2

  • Positive control

    • Mouse embryo tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab218042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.
  • Tissue specificity

    Isoform 5 is expressed in keratinocytes, fibroblasts and melanocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 19 PbH1 repeats.
    Contains 1 UBR-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • F box only protein 11 antibody
    • F box protein 11 antibody
    • F-box only protein 11 antibody
    • FBX11 antibody
    • FBX11_HUMAN antibody
    • Fbxo11 antibody
    • PRMT9 antibody
    • Protein arginine N methyltransferase 9 antibody
    • Ubiquitin protein ligase E3 component n recognin 6 antibody
    • UBR6 antibody
    • UG063H01 antibody
    • VIT 1 antibody
    • VIT-1 antibody
    • VIT1 antibody
    • Vitiligo associated protein 1 antibody
    • Vitiligo associated protein VIT 1 antibody
    • Vitiligo-associated protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Mouse embryo tissue, labeling FBXO11 with ab218042 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up