Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human FBXO2 aa 1-296.
    Sequence:

    MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDEL PEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPE GGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEE LPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPA IVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGW MEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP


    Database link: Q9UK22

  • Positive control

    • IHC-P: Human brain tissue and glioma cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 1 FBA (F-box associated) domain.
  • Cellular localization

    Cytoplasm. Microsome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • F box gene 1 antibody
    • F box only protein 2 antibody
    • F box protein 2 antibody
    • F box protein only 2 antibody
    • F-box only protein 2 antibody
    • FBG 1 antibody
    • FBG1 antibody
    • Fbs 1 antibody
    • Fbs1 antibody
    • Fbs2 antibody
    • FBX 2 antibody
    • FBX2 antibody
    • FBX2_HUMAN antibody
    • FBXO 2 antibody
    • FBXO2 antibody
    • Neural F box protein NFB42 antibody
    • Neural F-box protein, 42-KD, rat, homolog of antibody
    • NFB 42 antibody
    • NFB42 antibody
    • OCP1 antibody
    • organ of Corti protein 1 antibody
    • Prpl4 antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for FBXO2 using ab230307 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma cancer tissue stained for FBXO2 using ab230307 at 1/100 dilution in immunohistochemical analysis.

References

ab230307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up