Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXO22
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FBXO22 aa 104-403.
    Sequence:

    YMADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGI VVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLER HQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGG QVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAE AAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVP LFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK


    Database link: Q8NEZ5

  • Positive control

    • WB: Mouse heart lysate; HeLa, MCF7 and HepG2 whole cell lysates. IHC-P: Human liver cancer and tonsil tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa).

Target

Images

  • All lanes : Anti-FBXO22 antibody (ab230395) at 1/1000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 45 kDa
    Observed band size: 45 kDa

  • Paraffin-embedded human tonsil tissue stained for FBXO22 using ab230395 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for FBXO22 using ab230395 at 1/100 dilution in immunohistochemical analysis.

References

ab230395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up