Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXO4/FBX4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human FBXO4/FBX4 aa 252-301 (internal sequence).
    Sequence:

    TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK


    Database link: NP_277019

  • Positive control

    • 293T cell lysate.
  • General notes

     This product was previously labelled as FBXO4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab83318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Function

    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes ubiquitination of CCND1 and its subsequent proteasomal degradation. Recognizes TERF1 and promotes its ubiquitination together with UBE2D1.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
  • Post-translational
    modifications

    Phosphorylation at Ser-12 varies during the cell cycle. It is low in resting cells and high in the S phase and the G2/M phase of the cell cycle. Phosphorylation is decreased during late G1 phase (By similarity). Phosphorylation at Ser-12 promotes homodimerization and is necessary for optimal ubiquitin ligase activity towards CCND1.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp547N213 antibody
    • F box only protein 4 antibody
    • F box protein 4 antibody
    • F box protein Fbx4 antibody
    • F-box only protein 4 antibody
    • FBX4 antibody
    • FBX4_HUMAN antibody
    • FBXO 4 antibody
    • FBXO4 antibody
    • FLJ10141 antibody
    see all

Images

  • Anti-FBXO4/FBX4 antibody (ab83318) at 1 µg/ml (in 5% skim milk/PBS buffer) + 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 44 kDa
    Observed band size: 44 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Kwon DH  et al. MDM2 E3 ligase-mediated ubiquitination and degradation of HDAC1 in vascular calcification. Nat Commun 7:10492 (2016). Read more (PubMed: 26832969) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up