Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXW5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FBXW5 aa 265-494.
    Sequence:

    LLLEAGDPATSPCRIFDLGSDNEEVVAGPAPAHAKEGLRHFLDRVLEGRA QPQLSERMLETKVAELLAQGHTKPPERSATGAKSKYLIFTTGCLTYSPHQ IGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDIHGHIIGMGLSPDN RYLYVNSRAWPNGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHR AYTPNDECFFIFLDVSRDFVASGAEDRHGY


    Database link: Q969U6

  • Positive control

    • WB: PC-3, Jurkat, HeLa and HEK-293T whole cell lysates. IHC-P: Human appendix tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 64 kDa.

Target

  • Relevance

    FBXW5 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW5 contains WD-40 domains, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene, however, they were found to be nonsense-mediated mRNA decay (NMD) candidates, hence not represented.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • F box and WD 40 domain containing protein 5 antibody
    • F box and WD repeat domain containing 5 antibody
    • F box WD repeat containing protein 5 antibody
    • F box/WD repeat containing protein 5 antibody
    • F-box/WD repeat-containing protein 5 antibody
    • FBW5 antibody
    • FBXW5 antibody
    • WD repeat containing F box protein FBW5 antibody
    see all

Images

  • All lanes : Anti-FBXW5 antibody (ab234773) at 1/1000 dilution

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 64 kDa

  • Paraffin-embedded human appendix tissue stained for FBXW5 using ab234773 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for FBXW5 (green) using ab234773 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab234773 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up