Overview

  • Product name

  • Description

    Rabbit polyclonal to FBXW8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FBXW8 aa 178-275.
    Sequence:

    KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGY TSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA


    Database link: Q8N3Y1

  • Positive control

    • IHC: Human placenta tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Substrate-recognition component of a SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin-protein ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 5 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • F box and WD40 domain containing protein 8 antibody
    • F box only protein 29 antibody
    • F box/WD repeat containing protein 8 antibody
    • F-box and WD-40 domain-containing protein 8 antibody
    • F-box only protein 29 antibody
    • F-box/WD repeat-containing protein 8 antibody
    • FBW6 antibody
    • FBW8 antibody
    • FBX29 antibody
    • FBXO29 antibody
    • FBXW6 antibody
    • FBXW8 antibody
    • FBXW8_HUMAN antibody
    see all

Images

  • Paraffin-embedded human placenta tissue tissue stained for FBXW8 using ab224166 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for FBXW8 (green) using ab224166 at 4 µg/ml in ICC/IF.

References

ab224166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up