Overview

  • Product name

    Anti-Fc epsilon RI/FCER1A antibody
    See all Fc epsilon RI/FCER1A primary antibodies
  • Description

    Rabbit polyclonal to Fc epsilon RI/FCER1A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Fc epsilon RI/FCER1A aa 26-205.
    Sequence:

    VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEG QPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYY CTGKVWQLDYESEPLNITVIKAPREKYWLQ


    Database link: P12319

  • Positive control

    • IHC-P: Human prostate cancer and skin tissues. ICC/IF: HeLa cells. WB: Mouse heart and brain lysates.
  • General notes

     This product was previously labelled as Fc epsilon RI

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/5000. Detects a band of approximately 30 kDa (predicted molecular weight: 30 kDa).

Target

  • Function

    Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Fc epsilon RI alpha antibody
    • Fc epsilon RI alpha chain antibody
    • Fc epsilon RI alpha-chain antibody
    • Fc fragment of IgE high affinity I receptor for alpha polypeptide antibody
    • Fc fragment of IgE, high affinity I, receptor for, alpha subunit antibody
    • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide antibody
    • Fc IgE receptor alpha polypeptide antibody
    • Fc IgE receptor, alpha chain antibody
    • Fc IgE receptor, alpha polypeptide antibody
    • Fc of IgE high affinity I receptor for alpha polypeptide antibody
    • Fc-epsilon RI-alpha antibody
    • FCE 1A antibody
    • FCE1A antibody
    • FCER 1A antibody
    • Fcer1a antibody
    • FCERA_HUMAN antibody
    • FceRI alpha antibody
    • FcERI antibody
    • high affinity IgE receptor antibody
    • High affinity immunoglobulin epsilon receptor alpha subunit antibody
    • high affinity immunoglobulin epsilon receptor alpha-subunit antibody
    • High affinity immunoglobulin epsilon receptor subunit alpha antibody
    • IgE Fc receptor alpha subunit antibody
    • IgE Fc receptor subunit alpha antibody
    • Immunoglobulin E receptor high affinity of mast cells alpha polypeptide antibody
    • immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide antibody
    see all

Images

  • All lanes : Anti-Fc epsilon RI/FCER1A antibody (ab229889) at 1/2000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 30 kDa
    Observed band size: 30 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Fc epsilon RI/FCER1A (green) using ab229889 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human prostate cancer tissue stained for Fc epsilon RI/FCER1A using ab229889 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human skin tissue stained for Fc epsilon RI/FCER1A using ab229889 at 1/100 dilution in immunohistochemical analysis.

References

ab229889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up