Overview

  • Product name

    Anti-FCGRT/FCRN antibody [CL3640]
    See all FCGRT/FCRN primary antibodies
  • Description

    Mouse monoclonal [CL3640] to FCGRT/FCRN
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human FCGRT/FCRN aa 175-296.
    Sequence:

    LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAF SFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYC CIVQHAGLAQPLRVELESPAKS


    Database link: P55899

  • Epitope

    Binds to an epitope located within the peptide sequence GQGDFGPNSD as determined by overlapping synthetic peptides.
  • Positive control

    • WB: THP-1 (human monocytic leukemia cell line) cell lysate. IHC-P: Human lymph node, liver, placenta and colon tissue.
  • General notes

     This product was previously labelled as FCGRT

     

Properties

Applications

Our Abpromise guarantee covers the use of ab223381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/5000 - 1/10000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000.

Target

  • Function

    Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha chain antibody
    • Fc fragment of IgG, receptor transporter, alpha antibody
    • FCGRN_HUMAN antibody
    • FCGRT antibody
    • FcRn alpha chain antibody
    • FcRn antibody
    • FCRN, alpha chain antibody
    • IgG Fc fragment receptor transporter alpha chain antibody
    • IgG Gc receptor antibody
    • IgG receptor FcRn large subunit p51 antibody
    • IgG receptor FcRn large subunit p51 precursor antibody
    • Immunoglobulin receptor, intestinal, heavy chain antibody
    • Neonatal Fc receptor antibody
    see all

Images

  • Anti-FCGRT/FCRN antibody [CL3640] (ab223381) at 1/500 dilution + THP-1 (human monocytic leukemia cell line) whole cell lysate
  • Paraffin embedded human lymph node tissue stained for FCGRT/FCRN with ab223381 at a 1/5000 dilution in Immunohistochemical analysis.

  • Paraffin embedded human colon tissue stained for FCGRT/FCRN with ab223381 at a 1/5000 dilution in Immunohistochemical analysis.

  • Paraffin embedded human placenta tissue stained for FCGRT/FCRN with ab223381 at a 1/5000 dilution in Immunohistochemical analysis.

  • Paraffin embedded human liver tissue stained for FCGRT/FCRN with ab223381 at a 1/5000 dilution in Immunohistochemical analysis.

References

ab223381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up