Overview

  • Product name

    Anti-FCGRT/FCRN antibody - Extracellular domain
    See all FCGRT/FCRN primary antibodies
  • Description

    Rabbit polyclonal to FCGRT/FCRN - Extracellular domain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human FCGRT/FCRN aa 24-297 (extracellular).
    Sequence:

    AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGA WVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGP DNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANK ELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSA FSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHY CCIVQHAGLAQPLRVELESPAKSS


    Database link: P55899

  • Positive control

    • WB: HepG2 and A549 whole cell lysates, mouse liver, kidney and spleen tissue lysates. IHC-P: Human placenta and human pancreatic cancer tissues. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as FCGRT

     

Properties

Applications

Our Abpromise guarantee covers the use of ab193148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Detects a band of approximately 40 kDa (predicted molecular weight: 40 kDa).
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.
IHC-P 1/20 - 1/200.

Target

  • Function

    Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha chain antibody
    • Fc fragment of IgG, receptor transporter, alpha antibody
    • FCGRN_HUMAN antibody
    • FCGRT antibody
    • FcRn alpha chain antibody
    • FcRn antibody
    • FCRN, alpha chain antibody
    • IgG Fc fragment receptor transporter alpha chain antibody
    • IgG Gc receptor antibody
    • IgG receptor FcRn large subunit p51 antibody
    • IgG receptor FcRn large subunit p51 precursor antibody
    • Immunoglobulin receptor, intestinal, heavy chain antibody
    • Neonatal Fc receptor antibody
    see all

Images

  • All lanes : Anti-FCGRT/FCRN antibody - Extracellular domain (ab193148) at 2 µg

    Lane 1 : HepG2 whole cell lysate
    Lane 2 : Mouse liver tissue
    Lane 3 : Mouse spleen tissue
    Lane 4 : A549 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/1000 dilution

    Predicted band size: 40 kDa
    Observed band size: 40 kDa

  • All lanes : Anti-FCGRT/FCRN antibody - Extracellular domain (ab193148) at 5.3 µg/ml

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 40 kDa
    Observed band size: 39 kDa
    why is the actual band size different from the predicted?

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human placenta tissue labelling FCGRT/FCRN with ab193148 at a dilution of 1/100.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pancreatic cancer tissue labelling FCGRT/FCRN with ab193148 at a dilution of 1/100.

  • Immunocytochemistry/Immunofluorscence analysis of HepG2 cells labelling FCGRT/FCRN with ab193148 at a dilution of 1/100. An Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L) was used as the secondary antibody.

References

ab193148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up