Overview

  • Product name

    Anti-FCRL3 antibody [MM0733-17E23]
    See all FCRL3 primary antibodies
  • Description

    Mouse monoclonal [MM0733-17E23] to FCRL3
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human FCRL3 aa 14-568.
    Sequence:

    REQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEK LLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEG DNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHC TAYRKFYILDIEVTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLTCET QLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVE TVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQ GSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAADNV HSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPI LYRFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSH GVSLRVTVPVSRPVLTLRAPGAQAVVGDLLELHCESLRGSFPILYWFYHE DDTLGNISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTLNVT GTSRN


    Database link: Q96P31

  • General notes

    Produced from a hybridoma (Mouse myeloma fused with spleen cells from an immunized Mouse).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    The IgG fraction of culture supernatant was purified by Protein G affinity chromatography and 0.2 µM filtered.
  • Clonality

    Monoclonal
  • Clone number

    MM0733-17E23
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use at an assay dependent concentration.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ELISA Use at an assay dependent concentration.

Target

  • Tissue specificity

    Primarily expressed in secondary lymphoid tissues by mature subsets of B cells. Detected in spleen, lymph node, peripheral blood lymphocytes, thymus, bone marrow, kidney, salivary gland, adrenal gland and uterus. Expressed a low levels in naive, germinal center and memory B cells but also expressed in NK cells (at protein level).
  • Involvement in disease

    Genetic variation in FCRL3 may be a cause of susceptibility to rheumatoid arthritis (RA) [MIM:180300]. It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures.
    Genetic variation in FCRL3 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism.
  • Sequence similarities

    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    Phosphorylated on cytoplasmic tyrosines; required for interaction with protein tyrosine phosphatases and protein tyrosine kinases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD307c antibody
    • Fc receptor homolog 3 antibody
    • Fc receptor-like protein 3 antibody
    • FcR-like protein 3 antibody
    • FcRH3 antibody
    • FcRL3 antibody
    • FCRL3_HUMAN antibody
    • hIFGP3 antibody
    • IFGP family protein 3 antibody
    • IFGP3 antibody
    • Immune receptor translocation-associated protein 3 antibody
    • Immunoglobulin superfamily receptor translocation associated protein 3 antibody
    • IRTA3 antibody
    • SH2 domain-containing phosphatase anchor protein 2 antibody
    • SPAP2 antibody
    see all

References

ab201590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up