Anti-FCRL5 antibody (ab177204)
Key features and details
- Rabbit polyclonal to FCRL5
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-FCRL5 antibody
See all FCRL5 primary antibodies -
Description
Rabbit polyclonal to FCRL5 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human FCRL5 aa 79-254. (BC101067).
Sequence:ESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAE VTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSS NTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRF FRDDQTLGLGWSLSPNFQITAMWSKD
Database link: Q96RD9 -
Positive control
- MCF7 and HeLa whole cell lysate (ab150035); Human fetal stomach tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab177204 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500.
|
|
WB |
1/200 - 1/1000. Predicted molecular weight: 106 kDa.
|
Notes |
---|
IHC-P
1/100 - 1/500. |
WB
1/200 - 1/1000. Predicted molecular weight: 106 kDa. |
Target
-
Function
May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells. -
Tissue specificity
Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B cells and down-regulated in germinal center cells (at protein level). -
Involvement in disease
Note=A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup(1)(q21q32). -
Sequence similarities
Contains 8 Ig-like C2-type (immunoglobulin-like) domains. -
Domain
Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 83416 Human
- Omim: 605877 Human
- SwissProt: Q96RD9 Human
- Unigene: 415950 Human
-
Alternative names
- BXMAS1 antibody
- CD307 antigen antibody
- CD307e antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab177204 has not yet been referenced specifically in any publications.