Overview

  • Product name
  • Description
    Rabbit polyclonal to FCRL6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 143-192 (

    LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ

    ) of Human FCRL6 (NP_001004310).

  • Positive control
    • OVCAR3 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificity
    Expressed by cytolytic cells including NK cells, effector and effector-memory CD8+ T-cells. Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8+ T-cells but also populations of CD4+ T-cells.
  • Sequence similarities
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). The phosphorylated ITIM motif is involved in PTPN11 binding.
  • Post-translational
    modifications
    Phosphorylated on Tyr residue, inducing association with PTPN11.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Fc receptor homolog 6 antibody
    • Fc receptor-like 6 antibody
    • Fc receptor-like protein 6 antibody
    • Fc receptor-like protein 7 antibody
    • FcR-like protein 6 antibody
    • FcRH6 antibody
    • FcRL6 antibody
    • FCRL6_HUMAN antibody
    • FLJ16056 antibody
    • IFGP6 antibody
    • IgSF type I transmembrane receptor antibody
    • leukocyte receptor antibody
    see all

Images

  • Anti-FCRL6 antibody (ab99108) at 1 µg/ml + OVCAR3 Cell Lysate at 10 µg

    Predicted band size: 48 kDa



    12% SDS PAGE

References

ab99108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up